PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0647s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 426aa    MW: 47190.5 Da    PI: 8.3968
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0647s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32243296255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Kalax.0647s0009.1.p 243 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 296
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15240296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28241296IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23243296IPR006447Myb domain, plants
PfamPF002497.7E-7244295IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPSTT KPNHTALWPH TSRSSDQERV ADEEEDQEQS AMDLGFWNRA  60
LSNNDPSTTL SKQQTGPNPA PFNLSLSNPS IRVSSSSSPK SSNITFPHHH LLHTSSLPNP  120
NNLRHQATIV ATQNQQQQRG YMSMEPIKGI PIYHQNPARH HHPFTASTFP HQHPSLLLDS  180
FPASLPSSIT NTNSSSNIIN GGSQTCSPAA SCCQSSHHQT HHHGFLRTRF LSRFPGKKNM  240
RAPRMRWTST LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT  300
DKVAASSDAY ENGSSGDNSE DFMLDIHSSA RKQSDRQDQP SIASAAGGPN ALQDKNFQAL  360
WSNSLSREAW LHAGKQKDSL QGAMVSLQDM DDWRCSSIYE RSPEEIIIGR SMKKPNLEFT  420
LGRAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015898005.19e-96PREDICTED: probable transcription factor KAN2 isoform X3
SwissprotQ9C6161e-64KAN2_ARATH; Probable transcription factor KAN2
STRINGVIT_02s0012g01940.t019e-94(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.16e-63G2-like family protein